Skip to main navigation Skip to search Skip to main content

Release of CM-12 from A2-type casein by the cleavage of Ser–Leu–Xaa at the C-terminus using Aspergillus oryzae alkaline protease

  • Cui Yingjie
  • , Moe Fukunaga
  • , Nobuhiro Hayashi
  • , Kanami Orihara
  • , Kazuhiko Miyanaga
  • , Naoyuki Yamamoto

Research output: Contribution to journalArticlepeer-review

Abstract

BACKGROUND: Aspergillus oryzae protease can release the opioid peptide β-casomorphin-10 (CM-10, YPFPGPIPNS, 60–69) from A2-type casein. However, not only is the yield of the active peptide low, but the key enzyme involved in processing has yet to be identified. RESULTS: A significant amount of the opioid peptide 60YPFPGPIPNSLP71 (CM-12) was produced from the A2-type casein peptide 53AQTQSLVYPFPGPIPNSLPQNIPPLTQTPV82 when the active protease in A. oryzae protease extract was fractionated with DEAE-Sepharose. The fractionated enzyme produced CM-12 from bovine A2-type casein but not from bovine A1 casein. A major protein of 34 kDa was purified and identified as an alkaline protease (Alp). Motif prediction of the Alp cleavage site using Multiple EM for Motif Elicitation analysis revealed preferable cleavage at the C-terminal end of Ser–Leu–Xaa for the release of CM-12. A2-type casein hydrolysate by Alp exhibited similar levels of opioid activity to that of synthetic CM-12 in cAMP-Glo assays with μ-opioid receptor-expressing HEK293 cells. These results suggest that CM-12 is a major opioid peptide in the casein hydrolysate. CONCLUSION: Our findings showed that Alp fractionated from A. oryzae protease extract produced the opioid peptide CM-12 from A2-type casein as a result of preferential cleavage at the C-terminal end of Ser–Leu–Xaa and the removal of coexisting enzymes. Moreover, docking predictions suggested a stable interaction between CM-12 and the 3D structure of Alp. Casein hydrolysate with Alp-containing CM-12 has the potential for use as a bioactive peptide material with opioid activity.

Original languageEnglish
Pages (from-to)9210-9219
Number of pages10
JournalJournal of the Science of Food and Agriculture
Volume104
Issue number15
DOIs
Publication statusPublished - 12-2024
Externally publishedYes

All Science Journal Classification (ASJC) codes

  • Biotechnology
  • Food Science
  • Agronomy and Crop Science
  • Nutrition and Dietetics

Fingerprint

Dive into the research topics of 'Release of CM-12 from A2-type casein by the cleavage of Ser–Leu–Xaa at the C-terminus using Aspergillus oryzae alkaline protease'. Together they form a unique fingerprint.

Cite this